CAMPSQ5182
Title : DRP-AC1
GenInfo Identifier : 212287247
Source : Agalychnis callidryas [Red-eyed tree frog]
Taxonomy : Animalia, Amphibia
UniProt: B6HY16
PubMed : 18555027
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF12121 : DD_K ( Dermaseptin )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
IPR022731 : Dermaseptin.
IPR022731 :
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH_57 HMM
DermaseptinH27_5 HMM
DermaseptinH28_12 HMM
DermaseptinH32_4 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 75
Sequence:
 MAFLNKSLLLVLFLGLVSLSICEEERRENEDEEEQEDDEQSEMRRSLLSTLGNMAKAAGR
AALNAITGLVNQGEQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India