CAMPSQ5057
Title : Hepcidin
GenInfo Identifier : 194499453
Source : Bos mutus grunniens [Wild yak]
Taxonomy : Animalia, Mammals
UniProt: B5ANS7
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF06446 : Hepcidin ( Hepcidin )
InterPro : IPR010500 : Hepcidin.
IPR010500 :
Signature :
ID Type Pattern / HMM
CAMPHepH HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0005634 Cellular component Nucleus IEA
GO:0005507 Molecular function Copper ion binding IEA
GO:0006879 Biological process Cellular iron ion homeostasis IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0060586 Biological process Multicellular organismal iron ion homeostasis IEA
GO:0002262 Biological process Myeloid cell homeostasis IEA
GO:0045779 Biological process Negative regulation of bone resorption IEA
GO:0050728 Biological process Negative regulation of inflammatory response IEA
GO:1904479 Biological process Negative regulation of intestinal absorption IEA
GO:0034760 Biological process Negative regulation of iron ion transmembrane transport IEA
GO:0000122 Biological process Negative regulation of transcription by RNA polymerase II IEA
GO:1903364 Biological process Positive regulation of cellular protein catabolic process IEA
GO:0043032 Biological process Positive regulation of macrophage activation IEA
GO:0045944 Biological process Positive regulation of transcription by RNA polymerase II IEA
GO:0007259 Biological process Receptor signaling pathway via JAK-STAT IEA
GO:0010039 Biological process Response to iron ion IEA
Length : 82
Sequence:
MALNTQIRATCLLLLVLLSLTSGSVLPPQTRQLTDLQTKDTAGAAAGLTPVLQRRRRDTH
FPICIFCCGCCRKGTCGMCCRT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India