CAMPSQ4602
Title : Avian beta-defensin 6
GenInfo Identifier : 384236295
Source : Anas platyrhynchos (Mallard) [Domestic duck]
Taxonomy : Animalia, Aves
UniProt: B0FYP4
PubMed : 23112840
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Micrococcus tetragenus ATCC2835 , Lactobacillus ATCC33222, Staphylococcus aureus ATCC 29213, Bacillus cereus ATCC 9193, Bordetella bronchiseptica S80103, Proteus mirabilis ATCC29245, Pseudomonas aeruginosa ATCC 9027, Pasteurella multocida ATCC 6529, Escherichia coli BL21, Salmonella pullorum C79-11-S11, Salmonella choleraesuis CVCC 2140 ,Salmonella enteritidis ATCC 3021 , DHV-1
Hemolytic Activity :
Duck erythrocytes
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0051838 Biological process Cytolysis by host of symbiont cells IDA
Length : 67
Sequence:
MRILYLLLSVLFVVLQGVAGQPYFSSPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSC
CVRNRWA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India