CAMPSQ4500
Title : Defensin-2
Source : Pinus sylvestris [Scots pine]
Taxonomy : Animalia, Mammals
UniProt: A4L7R8
PubMed : 19253756
Activity : Antifungal
Validated : Predicted
InterPro : IPR008177 : G_Purothionin.
IPR008177 :
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region ISS
GO:0050832 Biological process Defense response to fungus ISS
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 50
Sequence:
 RMCKTPSAKFKGYCVSSTNCKNVCRTEGFPTGSCDFHITSRKCYCYKPCP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India