CAMPSQ4430
Title : Peptidoglycan recognition protein 1
Source : Camelus dromedarius [Arabian camel]
Taxonomy : Animalia, Mammals
UniProt: Q9GK12
PDB: 2R2K, 2R90, 2Z9N, 3C2X, 3CG9, 3COR, 3CXA, 3NG4, 3NKW, 3NNO, 3NW3, 3O4K, 3OGX, 3OLK, 3QJ1, 3QS0, 3QV4, 3RT4, 3T2V, 3T39, 3TRU, 3UIL, 3UML, 3UMQ, 3USX, 4EBS, 4EBT, 4FNN, 4GF9
Structure Database : CAMPST238
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Validated : Predicted
Pfam : PF01510 : Amidase_2 ( N-acetylmuramoyl-L-alanine amidase )
InterPro : IPR002502 : Amidase_domain.
IPR002502 :
IPR017331 : Peptidoglycan_recognition.
IPR017331 :
IPR015510 : PGRP.
IPR015510 :
IPR006619 : PGRP_domain_met/bac.
IPR006619 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0008745 Molecular function N-acetylmuramoyl-L-alanine amidase activity IEA
GO:0042834 Molecular function Peptidoglycan binding ISS
GO:0008270 Molecular function Zinc ion binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0001818 Biological process Negative regulation of cytokine production IDA
GO:0009253 Biological process Peptidoglycan catabolic process IEA
Length : 172
Sequence:
 REDPPACGSIVPRREWRALASECRERLTRPVRYVVVSHTAGSHCDTPASCAQQAQNVQSY
HVRNLGWCDVGYNFLIGEDGLVYEGRGWNIKGAHAGPTWNPISIGISFMGNYMNRVPPPR
ALRAAQNLLACGVALGALRSNYEVKGHRDVQPTLSPGDRLYEIIQTWSHYRA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India