CAMPSQ4363
Title : Defensin-1
Source : Apis mellifera carnica [Carniolan bee]
Taxonomy : Animalia, Insects
UniProt: Q5J8R1
PubMed : 15607651
Activity : Antibacterial
Gram Nature : Gram+ve
Validated : Predicted
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR017982 : Defensin_insect.
IPR017982 :
IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 51
Sequence:
VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India