CAMPSQ4347
Title : Antifungal protein
Source : Penicillium chrysogenum ATCC 28089 / DSM 1075 / Wisconsin
Taxonomy : Fungi
UniProt: B6GXZ8
Activity : Antifungal
Target :
Polytrichum commune Pc332, Polytrichum echinulatum Pe321, Aspergillus niger An261
Validated : Predicted
Pfam : PF11402 : Antifungal_prot ( Antifungal protein )
InterPro : IPR023112 : Antifungal-protein_domain.
IPR023112 :
IPR022706 : Antifungal_prot.
IPR022706 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region ISS
GO:0050832 Biological process Defense response to fungus ISS
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 58
Sequence:
 LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India