| CAMPSQ4344 |
| Title : |
Defensin D2 |
| Source : |
Nigella sativa [Black cumin] |
| Taxonomy : |
Plantae |
| UniProt: |
P86973 |
| PubMed : |
21144761 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
Aspergillus niger ( IC 50 = 3.5 microg/ml ), Bipolaris sorokiniana ( IC 50 = 1.8 microg/ml ), Fusarium oxysporum ( IC 50 = 5.3 microg/ml ), Fusarium graminearum ( IC 50 = 6.9 microg/ml ), Fusarium culmorum ( IC 50 = 6.9 microg/ml ), Botrytis cinerea ( IC 50 = 13.7 microg/ml ), Phytophthora infestans ( IC50 3.4 microg/ml ), Clavibacter michiganensis, Bacillus subtilis , Pseudomonas syringae, Erwinia carotovora, Escherichia coli |
| Validated : |
Experimentally validated |
| InterPro : |
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IDA |
| GO:0050829 |
Biological process |
Defense response to Gram-negative bacterium |
IDA |
| GO:0050830 |
Biological process |
Defense response to Gram-positive bacterium |
IDA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IDA |
|
| Length : |
50 |
Sequence: |
KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKLPAHRCICYYEC |