CAMPSQ4295
Title : Interleukin-6
GenInfo Identifier : 309707237
Source : Oncorhynchus mykiss [Rainbow trout]
Taxonomy : Animalia, Pisces
UniProt: E3Q1F7
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished
Pfam : PF00489 : IL6 ( Interleukin-6/G-CSF/MGF family )
InterPro : IPR009079 : 4_helix_cytokine-like_core.
IPR009079 :
IPR012351 : 4_helix_cytokine_core.
IPR012351 :
IPR003573 : IL6_MGF_GCSF.
IPR003573 :
IPR003574 : Interleukin_6.
IPR003574 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0005125 Molecular function Cytokine activity IEA
GO:0005138 Molecular function Interleukin-6 receptor binding IEA
GO:0042976 Biological process Activation of Janus kinase activity IMP
GO:0006953 Biological process Acute-phase response IEA
GO:0071347 Biological process Cellular response to interleukin-1 IDA
GO:0071354 Biological process Cellular response to interleukin-6 IDA
GO:0071222 Biological process Cellular response to lipopolysaccharide IDA
GO:1902615 Biological process Immune response involved in response to exogenous dsRNA IDA
GO:0061517 Biological process Macrophage proliferation IDA
GO:0010629 Biological process Negative regulation of gene expression IDA
GO:0010628 Biological process Positive regulation of gene expression IDA
GO:0045089 Biological process Positive regulation of innate immune response IMP
GO:0033141 Biological process Positive regulation of peptidyl-serine phosphorylation of STAT protein IDA
GO:0042531 Biological process Positive regulation of tyrosine phosphorylation of STAT protein IDA
GO:0072540 Biological process T-helper 17 cell lineage commitment IEA
Length : 199
Sequence:
 NPVPSALSELMTSGWTSGEELGTDGETGAPPKWEKMIKMLVHEVTTLRNQQFVEEFQKPV
EEISSFSQHQVPSTPPHLSKTLCSTSNKEACLQEISRGLQVYQLLLQHVKAEYPQSTLLP
SVTHQTTVLIGLVKDQMKVAEVVEDLSASERKRVLGEVSTGTEWERKTSVHAILRELRNF
LVDTKRALRRMGKRGKDFQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India