CAMPSQ4289
Title : Hepcidin
GenInfo Identifier : 282167192
Source : Crocodylus siamensis [Siamese crocodile]
Taxonomy : Animalia
UniProt: E8ZAD0
PubMed : 22967859
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
The inhibition ratio of the hepcidin expression in the supernatant to S. aureus, B. subtilis, E. coli and A. sobria was 69.2 +/- 0.5%, 85.7 +/- 0.6%, 76.0 +/- 0.7% and 51.7 +/- 3.3%, respectively.
Validated : Experimentally validated
Pfam : PF06446 : Hepcidin ( Hepcidin )
InterPro : IPR010500 : Hepcidin.
IPR010500 :
AMP Family : Hepcidin
Signature :
ID Type Pattern / HMM
HepcidinH_22 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0006879 Biological process Cellular iron ion homeostasis IEA
Length : 99
Sequence:
 MKVLAACVFLLLLVLLHGSPAACSALRAQANIGLMPRPETGAQSHGLEAAAGLMPHPEIG
AQSLEVPLRRSKRFNSHFPICSYCCNCCRNKGCGLCCRT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India