CAMPSQ4186
Title : Hepcidin
GenInfo Identifier : 401891205
Source : Chlorophthalmus bicornis [spinyjaw greeneye]
Taxonomy : Animalia, Pisces
UniProt: J7I901
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished
Pfam : PF06446 : Hepcidin ( Hepcidin )
InterPro : IPR010500 : Hepcidin.
IPR010500 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0006879 Biological process Cellular iron ion homeostasis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 56
Sequence:
ELEEPMNNDNPVVVHEEMSEESWKMPYNRQKRNPAGCRFCCGCCPNMRGCGVCCKF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India