CAMPSQ4182
Title : Preprobrevinin-2Kb
GenInfo Identifier : 399143579
Source : Rana kukunoris [plateau brown frog]
Taxonomy : Animalia, Amphibia
UniProt: J7FJF9
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR012521 :
IPR004275 : Brevinin.
IPR004275 :
Signature :
ID Type Pattern / HMM
RanateurinH32_9 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0006955 Biological process Immune response IEA
Length : 78
Sequence:
MFTSKKSMLLFFFLGTISLSLCQEEERGADEDEVVEEEVKRGLLSVFKGVLKAAGKNVAK
NVAGSLLDQLKCKISGGC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India