CAMPSQ4151
Title : Esculentin-2JDa
GenInfo Identifier : 410591613
Source : Odorrana jingdongensis [Jingdong frog]
Taxonomy : Animalia, Amphibia
UniProt: B3A0M8
PubMed : 22917879
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Staphylococcus aureus (ATCC 25923) ( MIC=32microg/ml ), Methicillin-resistant S. aureus (MRSA, CIB 85462) ( MIC=32microg/ml ), Escherichia coli (ATCC 25922) ( MIC=128microg/ml ), Extended-spectrum-lactamases E. coli (ESBL, CIB 84492) ( MIC=128microg/ml)
Hemolytic Activity :
No detectable hemolysis at 128 microg/ml
Validated : Experimentally validated
Comment : Inactive against Candida albicans
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR012521 :
AMP Family : Esculentin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 37
Sequence:
GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India