| CAMPSQ3981 |
| Title : |
Defensin Ec-AMP-D1 |
| Source : |
Echinochloa crus-galli [Barnyard grass] |
| Taxonomy : |
Plantae |
| UniProt: |
P86518 |
| PubMed : |
18625284 |
| Activity : |
Antifungal |
| Target : |
Fusarium graminearum (IC50=15 microg/ml), Fusarium oxysporum (IC50=102 microg/ml), Fusarium verticillioides (IC50=8.5 microg/ml), D.maydis (IC50=12.5 microg/ml), Phytophthora infestans (IC50=25.5 microg/ml) |
| Validated : |
Experimentally validated |
| InterPro : |
IPR008177 : G_Purothionin.
IPR008177 :
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
47 |
Sequence: |
RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKAC |