CAMPSQ3981
Title : Defensin Ec-AMP-D1
Source : Echinochloa crus-galli [Barnyard grass]
Taxonomy : Plantae
UniProt: P86518
PubMed : 18625284
Activity : Antifungal
Target :
Fusarium graminearum (IC50=15 microg/ml), Fusarium oxysporum (IC50=102 microg/ml), Fusarium verticillioides (IC50=8.5 microg/ml), D.maydis (IC50=12.5 microg/ml), Phytophthora infestans (IC50=25.5 microg/ml)
Validated : Experimentally validated
InterPro : IPR008177 : G_Purothionin.
IPR008177 :
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 47
Sequence:
RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKAC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India