CAMPSQ3970
Title : Defensin-1
Source : Pinus sylvestris [Scots pine]
Taxonomy : Plantae
UniProt: A4L7R7
PubMed : 19683554
Activity : Antifungal
Target :
Botrytis cinera ( IC50 = 0.4 microg/ml ), Fusarium oxysporum ( IC50 = 2.9 microg/ml ), Fusarium solani ( IC50 = 0.9 microg/ml ), Heterobasidion annosum ( IC50 = 1.4 microg/ml ), Candida albicans,Trichoderma reesei
Validated : Experimentally validated
Comment : Inactive against Escherichia coli, Erwinia carotovora
InterPro : IPR008177 : G_Purothionin.
IPR008177 :
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 50
Sequence:
 RMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India