CAMPSQ3969
Title : Cysteine-rich antifungal protein 1
Source : Brassica napus [Rape]
Taxonomy : Plantae
UniProt: P69240
PubMed : 8422949
Activity : Antifungal
Target :
Alternaria brassicola ( IC50 = 0.6 microg/ml) , Botrytis cinerea ( IC50 = 2 microg/ml) , Fusarium culmorum ( IC50 = 2.8 microg/ml) , Fusarium oxysporum f.sp.lycopersici ( IC50 = 1.3 microg/ml) , Pyricularia oryzae ( IC50 = 0.35 microg/ml) , Verticiliium dahliae ( IC50 = 1.2 microg/ml)
Validated : Experimentally validated
InterPro : IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 44
Sequence:
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India