CAMPSQ3940
Title : Big defensin
Source : Argopecten irradians [Bay scallop]
Taxonomy : Animalia, Molluscs (Bivalvia)
UniProt: Q0H293
PubMed : 16597463
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
Pfam : PF14862 : Defensin_big ( Big defensin )
InterPro : IPR028060 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050832 Biological process Defense response to fungus IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IMP
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 84
Sequence:
AIPIAYVGMAVAPQVFRWLVRAYGAAAVTAAGVTLRRVINRSRSNDNHSCYGNRGWCRSS
CRSYEREYRGGNLGVCGSYKCCVT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India