CAMPSQ390
Title : Fabatin-1
GenInfo Identifier : 3913645
Source : Vicia faba [Broad bean]
Taxonomy : Plantae
UniProt: P81456
PubMed : 9103978
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
P.aeruginosa, E.coli, E.hirae
Validated : Experimentally validated
Comment : Inactive against C.albicans, Saccharomyces cerevisiae
InterPro : IPR008177 : G_Purothionin.
IPR008177 :
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 47
Sequence:
LLGRCKVKSNRFHGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India