CAMPSQ388
Title : Neutrophil defensin 4
GenInfo Identifier : 3913453
Source : Mesocricetus auratus [Golden hamster]
Taxonomy : Animalia, Mammals
UniProt: P81468
PubMed : 8890190
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Staphylococcus aureus, Streptococcus pyogenes, Enterococcus faecalis, Escherichia coli, Salmonella serotype krefeld, Klebsiella oxytoca, Pseudomonas aeruginosa, Candida albicans, Cryptococcus neoformans
Validated : Experimentally validated
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
InterPro : IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
IPR006081 : Mammalian_defensins.
IPR006081 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH33_12 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 33
Sequence:
VTCFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India