CAMPSQ3877
Title : Defensin-1
Source : Crassostrea virginica [Eastern oyster]
Taxonomy : Animalia, Molluscs (Bivalvia)
UniProt: P85008
PubMed : 16297885
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Lactococcus lactis subsp. lactis ( Minimum effective concentrations ( MECs = 2.4 microg/ml ), Staphylococcus aureus ( MECs = 3.0 microg/ml ), Escherichia coli D31 ( MECs = 7.6 microg/ml ), Vibrio parahemolyticus ( MECs = 15.0 microg/ml )
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
Length : 38
Sequence:
GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India