| CAMPSQ3877 |
| Title : |
Defensin-1 |
| Source : |
Crassostrea virginica [Eastern oyster] |
| Taxonomy : |
Animalia, Molluscs (Bivalvia) |
| UniProt: |
P85008 |
| PubMed : |
16297885 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
Lactococcus lactis subsp. lactis ( Minimum effective concentrations ( MECs = 2.4 microg/ml ), Staphylococcus aureus ( MECs = 3.0 microg/ml ), Escherichia coli D31 ( MECs = 7.6 microg/ml ), Vibrio parahemolyticus ( MECs = 15.0 microg/ml ) |
| Validated : |
Experimentally validated |
| Pfam : |
PF01097 : Defensin_2 ( Arthropod defensin )
|
| InterPro : |
IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0050829 |
Biological process |
Defense response to Gram-negative bacterium |
IDA |
| GO:0050830 |
Biological process |
Defense response to Gram-positive bacterium |
IDA |
| GO:0045087 |
Biological process |
Innate immune response |
IDA |
|
| Length : |
38 |
Sequence: |
GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS |