CAMPSQ3851
Title : Subtilosin A1
GenInfo Identifier : 27734551
Source : Bacillus subtilis
Taxonomy : Monera
UniProt: O07623
PDB: 1PXQ
Structure Database : CAMPST60
PubMed : 19633086
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Bacillus subtilis ( MIC = 100 microM ), Bacillus anthracis ( MIC = 2.56 microM ), Bacillus cereus ( MIC = 6.4 microM ), Bacillus thuringiensis ( MIC = 6.4 microM ), ( MIC = 16 microM ), Staphylococcus carnosus ( MIC = 16 microM ), Listeria monocytogenes ( MIC = 40 microM ), Streptococcus pyogenes ( MIC = 100 microM )
Hemolytic Activity :
Rabbit erythrocytes ( Hemolytic activity at 16 microM )
Validated : Experimentally validated
Pfam : PF11420 : Subtilosin_A ( Bacteriocin subtilosin A )
InterPro : IPR021539 : Subtilosin_A.
IPR021539 :
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM
BacteriocinH35_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 35
Sequence:
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India