CAMPSQ385
Title : Defensin
GenInfo Identifier : 3913449
Source : Bombus pascuorum [Brown bumblebee]
Taxonomy : Animalia, Insects
UniProt: P81462
PubMed : 9219367
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
M. luteus, E. coli D22
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR017982 : Defensin_insect.
IPR017982 :
IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 51
Sequence:
 VTCDLLSIKGVAEHSACAANCLSMGKAGGRCENGICLCRKTTFKELWDKRF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India