CAMPSQ381
Title : Abaecin
GenInfo Identifier : 3912960
Source : Bombus pascuorum [Common carder bumblebee]
Taxonomy : Animalia, Insects
UniProt: P81463
PubMed : 9219367
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
Pfam : PF08026 : Antimicrobial_5 ( Bee antimicrobial peptide )
InterPro : IPR012524 : Abaecin_antimicrobial_peptide.
IPR012524 :
AMP Family : Abaecin
Signature :
ID Type Pattern / HMM
AbaecinH_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0042381 Biological process Hemolymph coagulation IEA
Length : 39
Sequence:
FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India