CAMPSQ3621
Title : Hedyotide B1
GenInfo Identifier : 365824243
Source : Hedyotis biflora
Taxonomy : Plantae
UniProt: G9I0X2
PubMed : 21979955
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli ( MIC = 3.4 microM ), Streptococcus salivarius ( MIC = 5.9 microM )
Validated : Experimentally validated
Comment : Inactive against Staphylococcus epidermidis, Staphylococcus aureus ( up to 80 microM )
Pfam : PF03784 : Cyclotide ( Cyclotide family )
InterPro : IPR005535 : Cyclotide.
IPR005535 :
AMP Family : Cyclotide
Signature :
ID Type Pattern / HMM
CyclotideH30_27 HMM
CyclotideH_67 HMM
CyclotideP30_27 Pattern C-[FV]-x-[GIL]-x-C-x-[STV]-[AGNPST]-x(3)-[CG]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0006952 Biological process Defense response IEA
Length : 30
Sequence:
GTRCGETCFVLPCWSAKFGCYCQKGFCYRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India