CAMPSQ295
Title : Pandinin-1
GenInfo Identifier : 25453143
Source : Pandinus imperator [Emperor scorpion]
Taxonomy : Animalia, Arachnida
UniProt: P83239
PubMed : 11563967
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
P.aeruginosa ( MIC = >20.8 microM ), E. coli ( MIC = 20.8 microM ), E. faecalis ( MIC = 1.3 microM ), C. albicans ( MIC = >20.8 microM ), B. subtilis ( MIC = 5.2 microM ), S. epidermidis ( MIC = 5.2 microM ), S. aureus ( MIC = 2.6 microM )
Validated : Experimentally validated
Pfam : PF08102 : Antimicrobial_7 ( Scorpion antimicrobial peptide )
InterPro : IPR012526 : Antimicrobial_7.
IPR012526 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016021 Cellular component Integral component of membrane IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0006811 Biological process Ion transport IEA
Length : 44
Sequence:
GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India