CAMPSQ2655
Title : Big defensin 2
GenInfo Identifier : 332692913
Source : Crassostrea gigas [Pacific oyster]
Taxonomy : Animalia, Molluscs (Bivalvia)
UniProt: F6M2J3
PubMed : 21980497
Activity : Antimicrobial
Validated : Predicted
Pfam : PF14862 : Defensin_big ( Big defensin )
InterPro : IPR028060 :
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016021 Cellular component Integral component of membrane IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
Length : 42
Sequence:
QAQALLPIASYAGLAVSPPVFAALVTAYGVYALYRYNIRREN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India