CAMPSQ2593
Title : Cecropin-P2
GenInfo Identifier : 74837091
Source : Ascaris suum [Pig roundworm]
Taxonomy : Animalia
UniProt: Q5H7N6
PubMed : 15850460
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Staphylococcus aureus IFO12732 ( MBC = 8 microg/ml ), Bacillus subtilis IFO3134 ( MBC = 20 microg/ml ), Micrococcus luteus IFO12708 ( MBC = 30 microg/ml ), Pseudomonas aeruginosa IFO3899 ( MBC = 20 microg/ml ), Salmonella typhimurium IFO13245 ( MBC = 20 microg/ml ), Serratia marcescens IFO3736 ( MBC = 30 microg/ml ), Escherichia coli JM109 ( MBC = 30 microg/ml ), Saccharomyces cerevisiae MAFF113011 ( MBC = 300 microg/ml ),Candida albicans IFO1060 ( MBC = 200 microg/ml )
Validated : Experimentally validated
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
IPR000875 :
AMP Family : Cecropin
Signature :
ID Type Pattern / HMM
CecropinH30_3 HMM
CecropinH_72 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region ISS
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0002776 Biological process Antimicrobial peptide secretion IDA
GO:0042742 Biological process Defense response to bacterium IEP
GO:0005576 Cellular component Extracellular region ISS
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0002776 Biological process Antimicrobial peptide secretion IDA
GO:0042742 Biological process Defense response to bacterium IEP
Length : 30
Sequence:
WLSKTYKKLENSAKKRISEGIAIAIQGGPR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India