CAMPSQ251
Title : Cecropin A1, Lepidopteran C.
GenInfo Identifier : 227386, 225797
Source : Bombyx mori [Silk moth]
Taxonomy : Animalia, Insects
UniProt: Q27239
PubMed : 2184991
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E. coli
Validated : Experimentally validated
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
IPR000875 :
AMP Family : Cecropin
Signature :
ID Type Pattern / HMM
CecropinH35_7 HMM
CecropinH_72 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 35
Sequence:
RWKLFKKIEKVGRNVRDGLIKAGPAIAVIGQAKSL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India