CAMPSQ2380
Title : Palustrin-2CG1 antimicrobial peptide precursor
GenInfo Identifier : 304442858
Source : Amolops chunganensis [Chungan torrent frog]
Taxonomy : Animalia, Amphibia
UniProt: E1B231
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
AMP Family : Palustrin
Signature :
ID Type Pattern / HMM
RanateurinH28_16 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 71
Sequence:
FTMKKPLLLLFFLGTISLSLCQEERGADEDDGEMTEEVKRGLWNTIKEAGKKFAINVLDK
IRCGIAGGCKT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India