CAMPSQ21405
Title : Fowlicidin-2
Source : Synthetic construct
UniProt: Q2IAL7
PDB: 2GDL
Structure Database : CAMPST561
PubMed : 20375584
Activity : Antibacterial
Gram Nature : Gram+, Gram-
Target :
Escherichia coli ATCC 25922[MIC = 2 microM], Salmonella enterica subsp. enterica serovar Enteritidis ATCC 13076[MIC = 1 microM], Klebsiella pneumoniae ATCC 13883[MIC = 2 microM], Listeria monocytogenes ATCC 19115[MIC = 2 microM], Staphylococcus aureus ATCC 25923[MIC = 0.5 microM], Staphylococcus aureus ATCC 25923[MIC = 2 microM], Staphylococcus aureus ATCC BAA-39[MIC = 01-2microM], Staphylococcus aureus ATCC 43300[MIC = 1 microM], Staphylococcus aureus ATCC 43300[MIC = 01-2microM]
Hemolytic Activity :
Human erythrocytes (100% Hemolysis at 200 microM
Validated : Experimentally Validated
InterPro : IPR001894 : Cathelicidin.
IPR001894 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0001530 Molecular function Lipopolysaccharide binding IMP
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0019835 Biological process Cytolysis IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0042116 Biological process Macrophage activation IDA
GO:0001818 Biological process Negative regulation of cytokine production IDA
GO:0005615 Cellular component Extracellular space IBA
GO:0001530 Molecular function Lipopolysaccharide binding IMP
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0019835 Biological process Cytolysis IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IDA
GO:0042116 Biological process Macrophage activation IDA
GO:0001818 Biological process Negative regulation of cytokine production IDA
Length : 31
Sequence:
LVQRGRFGRFLRKIRRFRPKVTITIQGSARF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India