| CAMPSQ2115 |
| Title : |
Cysteine-rich antifungal protein 3 precursor |
| GenInfo Identifier : |
11386628 |
| Source : |
Raphanus sativus [Radish] |
| Taxonomy : |
Plantae |
| UniProt: |
O24332 |
| PubMed : |
7780308 |
| Activity : |
Antifungal |
| Target : |
A. brassicola ( MIC = 2 microg/ml) , Botrytis cinerea ( MIC = 2 microg/ml) , F. culmorum ( MIC = 2 microg/ml) |
| Validated : |
Experimentally validated |
| InterPro : |
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
50 |
Sequence: |
KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC |