CAMPSQ211
Title : Ponericin-G2
GenInfo Identifier : 18202398
Source : Pachycondyla goeldii [Ponerine ant]
Taxonomy : Animalia, Insects
UniProt: P82415
PubMed : 11279030
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Saccharomyces cerevisae
Validated : Experimentally validated
Pfam : PF07442 : Ponericin ( Ponericin )
InterPro : IPR010002 : Ponericin.
IPR010002 :
AMP Family : Ponericin
Signature :
ID Type Pattern / HMM
PonericinH30_5 HMM
PonericinH_18 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 30
Sequence:
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India