CAMPSQ2099
Title : Beta-defensin109
GenInfo Identifier : 84028869
Source : Pan troglodytes [Chimpanzee]
Taxonomy : Animalia, Mammals
UniProt: Q30KL7
Activity : Antibacterial
Validated : Predicted
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IBA
GO:0045087 Biological process Innate immune response IEA
Length : 65
Sequence:
GLGPAEGHCLNLSGVCRRDVCKVVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPL
KRKLK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India