CAMPSQ205
Title : Circulin-B
GenInfo Identifier : 17433721
Source : Chassalia parviflora
Taxonomy : Plantae
UniProt: P56879
PDB: 2ERI
Structure Database : CAMPST118
PubMed : 10430870
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( MIC = 0.41 microM ), P. aeruginosa ( MIC = 25.5 microM ), Pr. Vulgaris ( MIC = 6.80 microM ), K. oxytoca ( MIC = 8.20 microM ), S. aureus ( MIC = 13.5 microM ), C. kefyr ( MIC = 29.0 microM )
Validated : Experimentally validated
Pfam : PF03784 : Cyclotide ( Cyclotide family )
InterPro : IPR005535 : Cyclotide.
IPR005535 :
IPR012323 : Cyclotide_bracelet_CS.
IPR012323 :
IPR017307 : Cyclotide_subgr.
AMP Family : Cyclotide
Signature :
ID Type Pattern / HMM
CyclotideH31_16 HMM
CyclotideH_67 HMM
CyclotideP31_16 Pattern C-[AEG]-[EG]-[ST]-C-x(2)-[GI]-x(4)-[APST]-x(3)-[CG]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
Length : 31
Sequence:
GVIPCGESCVFIPCISTLLGCSCKNKVCYRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India