CAMPSQ204
Title : Cyclopsychotride-A
GenInfo Identifier : 17433720
Source : Psychotria longipes
Taxonomy : Plantae
UniProt: P56872
PubMed : 10430870
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( MIC =1.55 microM), P.aeruginosa ( MIC =13.5 microM), Pr.vulgaris ( MIC =13.2 microM), K. oxytoca ( MIC =5.80 microM), S. aureus ( MIC =39.0 microM), M. luteus ( MIC =48.0 microM), C. albicans ( MIC =>500 microM), C. kefyr ( MIC =14.0 microM), C. tropicalis ( MIC =56.5 microM)
Validated : Experimentally validated
Pfam : PF03784 : Cyclotide ( Cyclotide family )
InterPro : IPR005535 : Cyclotide.
IPR005535 :
IPR012323 : Cyclotide_bracelet_CS.
IPR012323 :
IPR017307 : Cyclotide_subgr.
AMP Family : Cyclotide
Signature :
ID Type Pattern / HMM
CyclotideH31_16 HMM
CyclotideH_67 HMM
CyclotideP31_16 Pattern C-[AEG]-[EG]-[ST]-C-x(2)-[GI]-x(4)-[APST]-x(3)-[CG]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
Length : 31
Sequence:
SIPCGESCVFIPCTVTALLGCSCKSKVCYKN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India