CAMPSQ2036
Title : Beta-defensin 15
GenInfo Identifier : 209572894
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: Q32ZH6
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0019898 Cellular component Extrinsic component of membrane ISO
GO:1990742 Cellular component Microvesicle ISO
GO:0005634 Cellular component Nucleus ISO
GO:0031727 Molecular function CCR2 chemokine receptor binding ISO
GO:0008201 Molecular function Heparin binding ISO
GO:0001530 Molecular function Lipopolysaccharide binding ISO
GO:0061760 Biological process Antifungal innate immune response ISO
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0050830 Biological process Defense response to Gram-positive bacterium ISO
GO:0045087 Biological process Innate immune response ISO
Length : 59
Sequence:
FFDEKCSRINGRCTESCLKNEELIALCQKNLKCCVTVQPCGRDKGDELDEDSGYNRTRG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India