CAMPSQ2030
Title : Bone marrow proteoglycan
GenInfo Identifier : 3913581
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q61878
Activity : Antiparasitic
Validated : Predicted
Pfam : PF00059 : Lectin_C ( Lectin C-type domain )
InterPro : IPR001304 : C-type_lectin.
IPR001304 :
IPR016186 : C-type_lectin-like.
IPR016186 :
IPR016187 : C-type_lectin_fold.
IPR016187 :
IPR002352 : Eosinophil_major_basic.
IPR002352 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0062023 Cellular component Collagen-containing extracellular matrix HDA
GO:0030246 Molecular function Carbohydrate binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0002215 Biological process Defense response to nematode IMP
GO:0006955 Biological process Immune response IEA
GO:0032693 Biological process Negative regulation of interleukin-10 production IMP
GO:0032753 Biological process Positive regulation of interleukin-4 production IMP
Length : 117
Sequence:
 TCRYLLVRRAECFDKAQSVCRRCYRGTLASIHSFSVNFGIQSAVRGINQGQVWIGGRIKG
WGRCKRFRWVDGSSWNFAYWAAGQPCPGGGRCVTLCTQGGHWRLSHCVKRRPFICSY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India