CAMPSQ2025
Title : WAP four-disulfide core domain protein 12
GenInfo Identifier : 61216988
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: Q6IE40
Activity : Antibacterial
Validated : Predicted
Pfam : PF00095 : WAP ( WAP-type (Whey Acidic Protein) 'four-disulfide core' )
InterPro : IPR008197 : WAP-type_4-diS_core.
IPR008197 :
IPR029718 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0004867 Molecular function Serine-type endopeptidase inhibitor activity IBA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0042742 Biological process Defense response to bacterium ISS
GO:0045087 Biological process Innate immune response IBA
Length : 57
Sequence:
GGVKGAEKGVCPPDNVRCIRGEDPQCHNDNDCKDQKICCYWHCGFKCVQPVKDSWEQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India