CAMPSQ2001
Title : Beta-defensin 5
GenInfo Identifier : 123780122
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: Q32ZI3
Activity : Antibacterial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space ISO
GO:0031731 Molecular function CCR6 chemokine receptor binding ISO
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide ISO
GO:0060326 Biological process Cell chemotaxis IBA
GO:0006935 Biological process Chemotaxis ISO
GO:0042742 Biological process Defense response to bacterium ISO
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0050830 Biological process Defense response to Gram-positive bacterium ISO
GO:0031640 Biological process Killing of cells of other organism ISO
Length : 41
Sequence:
 QSINNPVSCVTHGGICWGRCPGSFRQIGTCGLGKVRCCKKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India