CAMPSQ1979
Title : Waprin-Phi3
GenInfo Identifier : 166227870
Source : Philodryas olfersii [Green snake]
Taxonomy : Animalia, Reptiles
UniProt: A7X4M7
Activity : Antibacterial
Hemolytic Activity :
No hemolytic activity
Validated : Predicted
Pfam : PF00095 : WAP ( WAP-type (Whey Acidic Protein) 'four-disulfide core' )
InterPro : IPR008197 : WAP-type_4-diS_core.
IPR008197 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0030414 Molecular function Peptidase inhibitor activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 58
Sequence:
KTTKQLRLPKVKPGECPKVKIPPDYPCNQYCVWDFDCEGNKKCCPVGCAKECFPPGPL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India