CAMPSQ1961
Title : Eosinophil cationic protein
GenInfo Identifier : 147744558
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P12724
PDB: 1DYT, 1H1H, 1QMT, 2KB5, 4A2O, 4A2Y
Structure Database : CAMPST496, CAMPST509, CAMPST537, CAMPST569, CAMPST310, CAMPST311
Activity : Antibacterial
Validated : Experimentally validated
Pfam : PF00074 : RnaseA ( Pancreatic ribonuclease )
InterPro : IPR001427 : RNaseA.
IPR001427 :
IPR023411 : RNaseA_AS.
IPR023411 :
IPR023412 : RNaseA_domain.
IPR023412 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0035578 Cellular component Azurophil granule lumen TAS
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0004519 Molecular function Endonuclease activity IEA
GO:0001530 Molecular function Lipopolysaccharide binding IDA
GO:0003676 Molecular function Nucleic acid binding IEA
GO:0004540 Molecular function Ribonuclease activity IBA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0006935 Biological process Chemotaxis IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0043152 Biological process Induction of bacterial agglutination IDA
GO:0045087 Biological process Innate immune response IDA
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0006401 Biological process RNA catabolic process TAS
GO:0035578 Cellular component Azurophil granule lumen TAS
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0004519 Molecular function Endonuclease activity IEA
GO:0001530 Molecular function Lipopolysaccharide binding IDA
GO:0003676 Molecular function Nucleic acid binding IEA
GO:0004540 Molecular function Ribonuclease activity IBA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0006935 Biological process Chemotaxis IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0043152 Biological process Induction of bacterial agglutination IDA
GO:0045087 Biological process Innate immune response IDA
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0006401 Biological process RNA catabolic process TAS
Length : 133
Sequence:
 RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSI
RCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSP
RYPVVPVHLDTTI

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India