CAMPSQ1937
Title : Cathelin
GenInfo Identifier : 462383
Source : Sus scrofa [pig]
Taxonomy : Animalia, Mammals
UniProt: P15175
Activity : Antimicrobial
Validated : Predicted
InterPro : IPR001894 : Cathelicidin.
IPR001894 :
IPR018216 : Cathelicidin_CS.
IPR018216 :
AMP Family : Cathelicidin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0045087 Biological process Innate immune response IBA
Length : 96
Sequence:
 QLRYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTR
QPPELCDFKEKQCVGTVTLNPSIHSLDISCNEIQSV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India