CAMPSQ1932
Title : Beta-defensin131
GenInfo Identifier : 37076854
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P59861
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IMP
GO:0071223 Biological process Cellular response to lipoteichoic acid IMP
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IMP
GO:0032722 Biological process Positive regulation of chemokine production IMP
GO:0002720 Biological process Positive regulation of cytokine production involved in immune response IMP
GO:0090026 Biological process Positive regulation of monocyte chemotaxis IMP
Length : 48
Sequence:
FISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India