CAMPSQ1925
Title : Beta-defensin119
GenInfo Identifier : 84028881
Source : Pan troglodytes [Chimpanzee]
Taxonomy : Animalia, Mammals
UniProt: Q30KK8
Activity : Antibacterial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0061760 Biological process Antifungal innate immune response IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
Length : 63
Sequence:
KRHILRRMGNSGICRASCKKNEQPYLYCRNYQSCCLQSYMRISISGKEENTDWSYEKQWP
RLP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India