CAMPSQ1872
Title : Beta-defensin103A
GenInfo Identifier : 152112317
Source : Pongo pygmaeus [Bornean orangutan]
Taxonomy : Animalia, Mammals
UniProt: A4H200
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 45
Sequence:
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India