CAMPSQ1870
Title : Beta-defensin104A
GenInfo Identifier : 152112319
Source : Hylobates lar [Common gibbon]
Taxonomy : Animalia, Mammals
UniProt: A4H204
Activity : Antimicrobial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 50
Sequence:
EFEWDRICGYGTARCRNKCRSQEYRIGRCPNTFACCLRKWDESLLNSTKP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India