CAMPSQ186
Title : Abaecin precursor
GenInfo Identifier : 1703044
Source : Apis mellifera [Honeybee]
Taxonomy : Animalia, Insects
UniProt: P15450
PubMed : 2298215
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Agrobacterium tumefaciens Gembloux A ( MIC = 25 - 50 microg/ml), Erwinia salicis NCPPB 2530 ( MIC = 25 - 50 microg/ml), E. coli NCTC 9001 ( MIC = 25 - 50 microg/ml), E. coli NCTC 9001 ( MIC = 10-25 microg/ml), E. coli K514 ( MIC = 10-25 microg/ml), Pseudomonas syringae pv. tomato NCPPB 1 105 ( MIC = 25 - 50 microg/ml), Xanthomonas campestris pv. vesicatoria LMG 905 ( MIC = 5-10 microg/ml), Bacillus megateriurn QMB 1551 ( MIC = 10-25 microg/ml), Micrococcus lysodeikticus LMG 4050 ( MIC = 10-25 microg/ml)
Validated : Experimentally validated
Pfam : PF08026 : Antimicrobial_5 ( Bee antimicrobial peptide )
InterPro : IPR012524 : Abaecin_antimicrobial_peptide.
IPR012524 :
AMP Family : Abaecin
Signature :
ID Type Pattern / HMM
AbaecinH_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0042381 Biological process Hemolymph coagulation IEA
Length : 34
Sequence:
 YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India