CAMPSQ1756
Title : Palustrin-3b
GenInfo Identifier : 119390856
Source : Odorrana versabilis [Chinese bamboo leaf odorous frog]
Taxonomy : Animalia, Amphibia
UniProt: Q1JS88
Activity : Antimicrobial
Validated : Predicted
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
AMP Family : Palustrin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 48
Sequence:
GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLSNIGNTGCNEDEC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India