CAMPSQ1720
Title : Liver-expressed antimicrobial peptide 2
GenInfo Identifier : 20138666
Source : Macaca mulatta [Rhesus macaque]
Taxonomy : Animalia, Mammals
UniProt: Q95M25
Activity : Antimicrobial
Validated : Predicted
Pfam : PF07359 : LEAP-2 ( Liver-expressed antimicrobial peptide 2 precursor (LEAP-2) )
InterPro : IPR009955 : LEAP-2.
IPR009955 :
AMP Family : LEAP-2
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 40
Sequence:
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India