CAMPSQ1655
Title : Probable cysteine-rich antifungal protein
GenInfo Identifier : 11386634
Source : Arabidopsis thaliana [Mouse-ear cress]
Taxonomy : Plantae
UniProt: O80995
Activity : Antifungal
Validated : Experimentally validated
InterPro : IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0099503 Cellular component Secretory vesicle HDA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 51
Sequence:
 QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYFPC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India